PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_022331-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 316aa    MW: 35244.2 Da    PI: 6.6221
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_022331-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed++l +++k +G g W++ +++ g++R++k+c++rw++yl
    NNU_022331-RA 14 RGAWTALEDKILTNYIKVHGEGKWRSLPKKAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding51.42.5e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++++lG++ W++Ia+ ++ gRt++++k++w++
    NNU_022331-RA  67 RGNITPDEEDLIIRLHRLLGNR-WSLIAAXLP-GRTDNEIKNYWNT 110
                      7999******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.918961IPR017930Myb domain
SuperFamilySSF466893.82E-2812108IPR009057Homeodomain-like
SMARTSM007173.0E-121363IPR001005SANT/Myb domain
PfamPF002491.5E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-221568IPR009057Homeodomain-like
CDDcd001672.71E-91661No hitNo description
PROSITE profilePS5129425.27862116IPR017930Myb domain
SMARTSM007171.6E-1566114IPR001005SANT/Myb domain
PfamPF002496.2E-1567110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2469116IPR009057Homeodomain-like
CDDcd001679.98E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MMKSACCSKE GLNRGAWTAL EDKILTNYIK VHGEGKWRSL PKKAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI TPDEEDLIIR LHRLLGNRWS LIAAXLPGRT DNEIKNYWNT SLGKKVKAGS  120
NSTLTPNNSN QSKQMKKKLI GSPPATEKES SIVRTKAVRC TKVYLRAQED QIEHINSVDF  180
ATTVAPTVGG DDHHMTHRTL EVVEPEFYNG LASFVSAEDN SSPNFMADLN EEELRLSDLL  240
GCDFSQLCGF DYGMVGEGSN GGDNDVFPSS SSGQRHCIPK EMLELENWTR SDGVQPAIVS  300
DIQSLASLIX DSEEDW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010241142.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A061GMC64e-93A0A061GMC6_THECC; GHMYB10, putative
STRINGVIT_11s0016g01300.t011e-89(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.15e-59MYB family protein